Back to jobsRemote
Freelance Agent Evaluation Engineer
MindriftRemoteAugust 22, 2026
$30 – $30 / year
Skills
cybersecuritydockerfastapijavascriptkafkamachine-learningpostgrespythonreactredistypescript
Job Description
Please submit your CV in English and indicate your level of English proficiency. Mindrift connects specialists with project-based AI opportunities for leading tech companies, focused on testing, evaluating, and improving AI systems. Participation is project-based, not permanent employment. We're building a dataset to evaluate AI coding agents - how well a model handles real-world developer tasks. You'll create challenging tasks and evaluation criteria within realistic simulated environments: Build realistic developer environments - a virtual company with codebase, infrastructure, and context (tickets, docs, conversations) that forms a believable development history Design tasks from intermediate states of these environments - craft the prompt, define what "solved" means, and ensure the task is solvable by an AI agent Write tests that verify agent solutions - accept all valid approaches and reject incorrect ones, neither too strict nor too lenient Iterate on tasks and tests based on QA feedback - review agent solutions, analyze failures, and refine until the evaluation is fair and robust What this is NOT: Not data labeling Not prompt engineering Not writing code from scratch - the agent writes most of the code; you guide and evaluate What we look for: 5+ years in software development Core stack: Python (FastAPI), JavaScript/TypeScript (React), Docker, Postgres, Kafka, Redis Experience writing tests (functional, integration) English proficiency - B2+ Why this is hard: Frontier models are already good at coding. Creating a task that genuinely challenges the best models is non-trivial. You need to deeply understand where models fail and what scenarios reveal the difference between a good and a bad solution. Tasks have many valid solutions - writing tests that accept all correct solutions and reject incorrect ones is harder than it sounds. Requirements and benefits Educational qualifications A Master’s Degree in Computer Science, Software Engineering, Data Science / Data Analytics, Artificial Intelligence / Machine Learning, Computational Linguistics / Natural Language Processing (NLP), Information Systems or other related fields. Bachelor’s degree is accepted if only candidate has 5 years of experience in the field. Academic and/or Professional Experience Candidates should have a minimum of 3 years of professional experience in related roles or domain - specifically for QA-automation/testing or cybersecurity roles How it works Apply → Pass qualification(s) → Join a project → Complete tasks → Get paid Compensation: Paid per accepted task. Your rate depends on the qualification tier you reach and how efficiently you complete tasks — up to the equivalent of $30/hr . Because payment is per task, a faster pace raises your effective hourly rate. Why this freelance opportunity might be a great fit for you? Take part in a part-time, remote, freelance project that fits around your primary professional or academic commitments. Work on advanced AI projects and gain valuable experience that enhances your portfolio. - Influence how future AI models understand and communicate in your field of expertise. Originally posted on Himalayas
Apply for this role
You'll be redirected to the company's application page