Back to jobsRemote
Lead Data Architect
Henry ScheinRemoteAugust 18, 2026
$181,026 – $259,094 / year
Skills
airflowawsazurebigquerycassandradata-engineeringdatabricksdbtgcpgdprgraphqlkafkamachine-learningmlopsmongodbmysqlnumpypandaspostgrespythonrest-apisnowflakesparksqlterraform
Job Description
We are looking for a Lead Data Architect to drive the strategic vision, design, and governance of our enterprise data architecture. This role will be instrumental in aligning data architecture with business objectives, ensuring seamless integration across systems, and optimizing data-driven decision-making. The ideal candidate will have a strong blend of technical expertise, leadership skills, and experience with modern data platforms like Databricks, Snowflake, and cloud-native solutions. This position is responsible for the overall management and oversight of our global data architecture. The individual will collaborate and build strong relationships across Henry Schein including with business leads and technology product teams, driving data architectures to aid with the implementation of database technologies as enablers for key business capabilities. You blend deep expertise and experience in engineering, technical design, systems and database management with a passion for coaching and mentoring engineering associates. KEY RESPONSIBILITIES: Data Strategy & Enterprise Architecture Define and implement a scalable, enterprise-wide data architecture aligned with business and technology goals. Develop a data strategy roadmap, ensuring long-term sustainability, scalability, and efficiency. Partner with executive leadership, product teams, and engineering to ensure data initiatives drive business value. Establish enterprise data governance, security, and compliance frameworks leveraging tools like Collibra or Alation. Technical Leadership & Innovation Define and implement a scalable, enterprise-wide data architecture aligned with business and technology goals. Oversee the design and evolution of data lakes, data warehouses, and cloud-based analytics platforms using Databricks, Snowflake, BigQuery, or Redshift. Lead the adoption of modern data architecture patterns, including event-driven architectures, real-time data streaming (Kafka, Pulsar), and AI-driven analytics. Provide guidance on database optimization, indexing, partitioning, and storage strategies for tools like PostgreSQL, MySQL, and NoSQL solutions like MongoDB or Cassandra. Evaluate emerging technologies, making recommendations for tools and platforms that enhance data capabilities. Data Engineering & Integration Direct ETL/ELT strategies, ensuring seamless data flow across systems with Python, Apache Airflow, dbt, or Informatica. Architect cloud-based solutions (AWS, Azure, or GCP) using services such as AWS Glue, Azure Synapse, and Google Cloud Dataflow to support analytics, AI, and operational use cases. Ensure API-first design for data integration using GraphQL, RESTful APIs, or event-driven architectures (Kafka, AWS Kinesis, Pub/Sub). Define and oversee data quality, lineage, and cataloging efforts using Great Expectations, Monte Carlo, or DataHub. Governance, Security & Compliance Develop policies for data privacy, access control, and encryption, ensuring compliance with GDPR, CCPA, HIPAA, or other relevant regulations. Implement enterprise-wide metadata management and data lineage tracking using Collibra, Alation, or Data Catalog solutions. Drive best practices for data security and compliance audits, leveraging IAM tools and cloud security solutions. Team Leadership & Collaboration Lead a team of data architects, engineers, and analysts, mentoring them on best practices. Act as a liaison between business and technical teams, translating business needs into scalable data solutions. Champion a culture of innovation, ensuring the data team is adopting cutting-edge methodologies. Conduct data architecture reviews, ensuring alignment with organizational standards. SPECIFIC KNOWLEDGE & SKILLS: 10+ years of experience in data architecture, data engineering, or related fields. Bachelor’s degree (Master’s preferred) in Computer Science, Applied Mathematics, Statistics, Machine Learning, or a closely related field (or foreign equivalent). Proven track record in designing large-scale, enterprise data architectures. Expertise in SQL, NoSQL, and distributed database technologies such as Snowflake, Databricks, BigQuery, Redshift, PostgreSQL, MongoDB, and Cassandra. Strong experience with cloud-based data platforms (AWS, Azure, GCP) and services like AWS Glue, Azure Data Factory, and Google Dataflow. Deep understanding of data modeling, ETL/ELT processes, and data pipeline optimization using dbt, Apache Airflow, Informatica, or Talend. Experience with real-time streaming technologies (Kafka, Spark Streaming, Apache Flink, AWS Kinesis). Strong knowledge of data security, governance, and compliance frameworks. Excellent verbal and written communication skills and ability to resolve disputes effectively and efficiently Outstanding presentation and public speaking skills Mastery independent decision making, analysis and problem-solving skills Ability to quickly understand and assess complex projects, systems and ecosystems and identify relevant relationships and connections between them Mastery planning and organizational skills and techniques Communicate effectively with senior management and key stakeholders Ability to influence, build relationships, understand organizational complexities, manage conflict and navigate politics Familiarity with the healthcare data domain with previous experience working with healthcare datasets is a plus Strong Python programming skills, with expertise in data manipulation and pipeline development using Pandas, PySpark, NumPy, and SQLAlchemy. Experience with AI/ML-driven analytics architectures and MLOps frameworks like MLflow or SageMaker. Hands-on experience with Infrastructure as Code (Terraform, CloudFormation). Familiarity with Graph databases and knowledge graphs (Neo4j, Amazon Neptune). Certifications in cloud data services (AWS Certified Data Analytics, Google Professional Data Engineer, Databricks Certified Data Engineer). GENERAL SKILLS & COMPETENCIES: Outstanding management and leadership skills and ability to attract, retain, motivate, develop, mentor and coach team members for high performance; good conceptual skills Outstanding verbal and written communication skills and ability to resolve disputes effectively and efficiently Outstanding presentation and public speaking skills Mastery independent decision making, analysis and problem solving skills Understand, interpret and act on financial information and external trends that contributes to business profitability Plan, manage and create strategy around complex projects; understand available resources, develop timeline, budget and assign areas of responsibility Lead teams to achieve company goals and solve complex business issues in creative and effective ways Mastery planning and organizational skills and techniques Communicate effectively with senior management and key stakeholders Excellent negotiating skills and ability to effectively manage strategic alliances, joint ventures and outsourced relationships Ability to influence, build relationships, understand organizational complexities, manage conflict and navigate politics Broad professional and managerial skills with a full understanding of industry practices and company policies and procedures Lead and develop virtual teams Mastery in multiple technical and business skills Excellent strategic planning skills MINIMUM WORK EXPERIENCE: Typically 12 or more years of increasing responsibility and complexity in terms of any applicable professional experience; 7 or more years of management experience. PREFERRED EDUCATION: Typically a Bachelor's Degree or global equivalent in related discipline. Master's degree or global equivalent a plus. TRAVEL / PHYSICAL DEMANDS: Travel typically less than 10%. Office environment. No special physical demands required. For US Applicants: The posted range for this position is $181,026 - $259,094 (for US based applicants only) which is the expected starting base salary range for an employee who is new to the role to fully proficient in the role. Many factors go into determining employee pay within the posted range including education, prior experience, training, current skills, certifications, location/labor market, internal equity, etc. Other benefits available include:Medical, Dental and Vision Coverage, 401K Plan with Company Match, PTO, Paid Parental Leave, Income Protection, Work Life Assistance Program, Flexible Spending Accounts, Educational Benefits, Worldwide Scholarship Program and Volunteer Opportunities. At the time of this posting, this position is eligible for a bonus not reflected in the posted range subject to the achievement of the plan. Information on pay transparency pursuant to Directive (EU) 2023/970: Please note that we comply with the relevant legal obligations regarding pay transparency, in particular those set forth in the EU Pay Transparency Directive (Directive (EU) 2023/970) and its respective national implementation. In this context, we will inform you of the starting salary or the corresponding salary range for the advertised position no later than before the first job interview or before a personal discussion of your application. This information is based on objective, gender-neutral criteria established for the position in question. Please note that we will not ask about your current or previous salary during the rest of the process in order to ensure equal pay. This notice does not constitute a claim to the conclusion of an employment contract or to a specific salary. For more information about career opportunities at Henry Schein , please visit our website at : www.henryschein.com/careers Henry Schein , Inc. is an Equal Employment Opportunity Employer and does not discriminate against applicants or employees on the basis of race, color, religion, creed, national origin, ancestry, disability that can be reasonably accommodated without undue hardship, sex, sexual orientation, gender identity, age, citizenship, marital or veteran status, or any
Apply for this role
You'll be redirected to the company's application page