Back to jobsRemote
Full Stack Software Engineer
DomainToolsRemoteJuly 24, 2026
Skills
agilecsscybersecuritydockerhtmljavascriptkuberneteslaravelmysqlphpreacttypescriptwebpack
Job Description
DomainTools is seeking a Software Engineer to join our Frontend Team. This position is perfect for someone interested in building powerful cybersecurity products and features for our enterprise customers. Our solutions help fuel mission critical efforts for customers including gathering threat intelligence, doing threat hunting, and performing online fraud investigation, and more. At DomainTools , you will work as part of a collaborative team of smart and engaged engineers. Expect to spend most of your time developing modern JavaScript single page applications powered by PHP middleware APIs. You will work in an environment where productivity is fostered. You will spend very little time in meetings, and you won’t be distracted by processes that get in the way of high-quality results. Have you worked with modern PHP OOP frameworks such as Laravel of Symfony? Are you well versed in using CSS and UX to make beautiful and streamlined designs? Have you built successful end to end testing solutions? If you answered yes to any of these questions we would like to chat with you. However, it is required that you are very comfortable with JavaScript. Job Responsibilities: Produce well designed, testable, efficient code using software development best practices. Integrate with and utilize data from backend services and databases. Build web applications using PHP on the backend and JavaScript (ES7+), HTML5, and CSS3 on the frontend. Contribute to new product ideation and implementation as well as to feature development of existing products. Collaborate with teammates by actively participating in code reviews, contributing to technical documentation, and offering constructive design feedback. Become a subject matter expert on DomainTools ’ customer facing products and services. Requirements Work experience: 3+ years of modern web application development. Experience with modern PHP frameworks (Laravel, Symfony). Solid knowledge of the following: Object oriented PHP 7+ programming JavaScript (ES7+) TypeScript HTML5 and CSS3 Deep understanding of React 18+ and Redux. Experience with unit and integration testing (PHPUnit, Jest). Demonstrable experience building and consuming APIs. Proficiency with version control systems, particularly Git. Experience with container technologies, particularly Docker. Pluses: Familiarity with configuring Babel, Webpack, and ESLint. Experience with orchestration platforms, particularly Kubernetes. Experience with user acceptance/E2E testing (TestCafe, Playwright). Familiarity interacting with relational databases (MySQL). Experience with UX design and related concepts. Experience using agile principles and methodologies. Bachelor’s degree or higher in Computer Science or a related field. Benefits DomainTools is the global leader for Internet intelligence and the first place security practitioners go when they need to know. The world’s most advanced security teams use our solutions to identify external risks, investigate threats, and proactively protect their organizations in a constantly evolving threat landscape. DomainTools constantly monitors the Internet and brings together the most comprehensive and trusted domain website and DNS data to provide immediate context and machine-learning driven risk analytics delivered in near real-time. DomainTools offers a comprehensive benefits package to our employees that includes fully paid medical, dental and vision insurance premiums, a 401k retirement plan with company matching, basic life insurance, flexible PTO and additional well-being benefits. DomainTools embraces diversity, equity and inclusion to its fullest as an equal opportunity employer. We build our teams so creativity and innovation can flourish. We believe inclusivity and equity fosters innovation and growth, and we harness this mindset to drive a culture that serves our employees and our customers. We encourage people of all backgrounds, ages, perspectives and skill sets to apply; and do not discriminate based on age, religion, color, national origin, gender, sexual orientation, gender identity, marital status, veteran status, disability or any other characteristic protected by law. Originally posted on Himalayas
Apply for this role
You'll be redirected to the company's application page