Back to jobs

Software Engineer, Reporting & Insights

Muck RackRemoteJuly 6, 2026
Remote
€22,000 – €22,000 / year
Skills
agiledjangoelasticsearchgdprkafkamysqlpythonvue

Job Description

Muck Rack is the leading SaaS platform for public relations and communications professionals. Our mission is to enable organizations to build trust, tell their stories, and demonstrate the unique value of earned media. Muck Rack ’s AI-powered, comprehensive, and integrated platform streamlines the PR workflow to help businesses generate positive media coverage, monitor mentions to manage brand reputation, and analyze PR’s impact on business outcomes. By combining media database, monitoring, and reporting into one dynamic platform, we empower teams to collaborate seamlessly, pitch effectively, and analyze results faster and more efficiently. Founder-controlled, fully distributed, and growing sustainably, Muck Rack has received several awards for its unparalleled culture and product from organizations like Inc., Quartz, G2, and BuiltIn. We value resilience, transparency, ownership, and customer devotion, and infuse these values into everything we do. We are looking for a Software Engineer to join our Reporting & Insights Team. This team builds the reporting and analytics capabilities that help customers understand the reach, impact, and performance of their media coverage and communications efforts. In this role, you will design and develop product features that power reporting, insights, and data analysis across the platform. You will collaborate closely with product managers, designers, data scientists, and engineers to deliver reliable and scalable solutions. You will also help maintain and improve the systems that support our reporting infrastructure while contributing to a collaborative engineering culture focused on quality and continuous improvement. What You'll Do: Design, build, and maintain features across our application that power reporting and insights capabilities Write clean, well-tested, and well-documented cod Collaborate with product managers, designers, and engineers to translate requirements into scalable technical solutions Participate in code reviews and help improve engineering standards and development practices Troubleshoot and resolve production issues to maintain platform reliability Contribute to architectural discussions and technical planning for upcoming features Participate in on-call rotations and help respond to incidents affecting production systems Get familiar with our systems, processes, and codebase while contributing to planned roadmap features What We're Looking For: Required Qualifications 3+ years of professional software development experience Strong proficiency in Python and experience building applications with the Django framework Hands-on experience with a modern frontend framework, preferably Vue.js Solid understanding of relational databases, particularly MySQL, and ORM patterns Experience designing and integrating RESTful APIs Experience using Git and collaborative development workflows Willingness to participate in an on-call rotation and support production systems Proactively incorporate AI tools into day to day work to improve productively and accelerate delivery Nice to Have Experience with analytical databases such as ClickHouse or Elasticsearch Experience working on data-heavy or high-traffic SaaS applications Familiarity with AI-assisted development tools such as Claude or GitHub Copilot Experience with data streaming platforms such as Kafka Experience using task queues or background job systems such as Celery Interview Overview Below you'll find an outline of the interview plan for this role. Please note that this is what we expect the process to look like; we may ask you for supplemental information or require an additional step before making a final decision. 30 min interview with a member of our Talent Team A one hour zoom interview with the hiring manager Take-home coding assignment (2-4 hours max) Peer interviews, including a 30 min code review discussion Final call(s) with executive team member(s) Location Preferences We are currently prioritizing candidates based in Bulgaria. Qualified candidates located in the United Kingdom and Ireland are also encouraged to apply. Travel & Team Engagement Expectations This role requires up to 10% travel for team collaboration, customer engagements, and company events. As part of our commitment to building strong connections across our fully distributed team, attendance at our annual company offsite (typically held in Mexico) is expected. Salary The anticipated salary range for this role in Bulgaria is €22,000 – 26,000+ annually, depending on experience. Individual compensation decisions are based on a number of factors, including experience level, skillset, and balancing internal equity relative to peers at the company. We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors. We recognize that the person we hire may be less experienced (or more senior) than this job description as posted. If that ends up being the case, the updated salary range will be communicated with you as a candidate. Why Muck Rack ? Remote Work, Forever Fully distributed team with a permanent remote setup Home office stipend, phone and internet reimbursement, coworking membership Virtual and in-person team bonding (lunches, events, competitions) Transparent & Fair Compensation Competitive geo-neutral pay in the U.S. Annual reviews to ensure equity and market alignment Standardized bonus or commission structure 401(k) with employer contributions Equity opportunities Health & Wellness Comprehensive medical, dental, vision, disability, and life insurance for employees and dependents 100% premium coverage for individuals on high-deductible plans 24/7 Virtual Care and Employee Assistance Program Employer-funded HSA contributions and other pre-tax benefits Quarterly wellness stipend and free Headspace subscription Time Off & Family Benefits 4+ weeks of PTO, plus paid sick and mental health days 13 paid holidays with the option to swap for personal days Up to 16 weeks of fully paid parental leave Learning and Development Transparent pathways for internal mobility and promotion Bi-annual performance reviews, team workshops, and leadership training Unlimited access to Coursera and O’Reilly 2 additional PTO days annually for learning and development Inclusive, Customer-First Culture Commitment to equity and valuing diverse perspectives Agile, founder-led company focused on collaboration and innovation Trusted by 3,000+ companies worldwide Note: Benefits and compensation reflect offerings for U.S.-based employees. Support is provided for employees in other locations, in compliance with local laws and regulations. While we are a fully distributed team, we do have limitations on where we can hire and maintain a list of acceptable working locations based on job function. If we are unable to hire in your current location for the role for which you applied, you will be notified via email. While we enjoy many benefits as a permanently distributed and remote company, we cannot always support relocation or extended travel and have guidelines in place to ensure compliant work away from your designated permanent residence. Please note: For detailed information regarding our GDPR and/or CCPA compliance policies, including how we handle personal data and privacy rights, kindly refer to the email correspondence accompanying this application. Muck Rack does not accept unsolicited resumes from search firms or any other third parties. Any unsolicited resume sent to Muck Rack will be considered Muck Rack property, and Muck Rack will not pay a fee should it hire the subject of any unsolicited resume. Muck Rack considers applicants for all positions on the basis of merit, qualifications, and business needs, and without regard to race, color, national origin, religion, sex, age, disability, sexual orientation, gender identity, alienage or citizenship status, ancestry, marital status, genetic predisposition or carrier status, veteran status, familial status, status as a victim of domestic violence, or any other status or characteristic protected by applicable federal, state, or local law. Note to applicants/job seekers: We have recently been made aware of scams impersonating Muck Rack ’s HR team. Please be cautious of these attempts to elicit banking or other financial or sensitive information. Muck Rack will never request financial information during the interview process, and follow ups for interviews or next steps will always come from an ‘@muckrack.com’ email address. If you are contacted by anyone from a different domain who claims to be from Muck Rack , please forward the communication to legal@muckrack.com . Originally posted on Himalayas
Apply for this role

You'll be redirected to the company's application page

Software Engineer, Reporting & Insights at Muck Rack | MyJobPhase